Liraglutide
aka Victoza
Mechanism
Liraglutide is an FDA-approved GLP-1 receptor agonist marketed as Victoza (type 2 diabetes, approved 2010) and Saxenda (chronic weight management, approved 2014). It was the first GLP-1 analog approved for obesity and carries an FDA boxed warning for the risk of thyroid C-cell tumors. Pediatric indications include type 2 diabetes in patients ≥10 years (Victoza) and obesity in patients ≥12 years with BMI ≥95th percentile (Saxenda).
Identification
| CAS number | 204656-20-2 |
|---|---|
| Molecular formula | C172H265N43O51 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR |
| Typical dose | 0.6–1.8 mg/day subcutaneous (diabetes); 0.6–3.0 mg/day subcutaneous (obesity/weight management) |
| Half-life | ~13 hours |
Vendors selling Liraglutide
| Vendor | Size | Price | Listed purity | Trust |
|---|---|---|---|---|
| Peptidegurus | 30 mg | — | — | 84 |
| Genetic Peptide | 5 mg | $100.00 | — | — |
| Genetic Peptide | 30 mg | $100.00 | — | — |
Research
Purpose Glucagon-like peptide-1 receptor agonists exhibit neuroprotective and anti-inflammatory effects; however, their role as perineural adjuvants in peripheral nerve blocks has not been investigated.
source →Objectives To determine the optimal timing for initiating liraglutide in patients with persistent obesity (BMI ≥ 28 kg/m² in China) six months after metabolic and bariatric surgery, a key gap in postoperative weight management.
source →It is unknown whether the glucagon-like peptide-1 (GLP-1) receptor agonists have a significant protective effect against acute islet injury.
source →Liraglutide, a glucagon-like peptide-1 (GLP-1) receptor agonist, restores hyperglycemic conditions in patients with type 2 diabetes and has recently shown promising anti-inflammatory properties.
source →Objective This study aimed to evaluate relationships between delayed gastric emptying and appetite suppression during treatment with liraglutide, a glucagon-like peptide-1 receptor agonist (GLP-1RA).
source →Glucagon-like peptide-1 receptor agonist liraglutide is widely used in type 2 diabetes mellitus and obesity and is generally considered non-hepatotoxic, with only rare reports of idiosyncratic liver injury.
source →Liraglutide, a glucagon-like peptide-1 receptor agonist, is widely used as a therapeutic macromolecule for the treatment of type 2 diabetes; however, its large-scale production is limited by high manufacturing costs and the frequent occurrence of closely related deletion impurities during synthesis.
source →Aims The glucagon-like peptide-1 receptor agonists (GLP-1 RAs) semaglutide and liraglutide are approved for chronic weight management.
source →Aim To compare the effects of liraglutide, dapagliflozin, and their combination on renal inflammation, oxidative stress, and fibrosis in streptozotocin (STZ)-induced diabetes in rats.
source →Oral delivery of peptide-based therapeutics remains a major challenge due to enzymatic degradation and poor intestinal permeability.
source →The purpose with the study is to assess pharmacokinetics of NEX-22A in patients with type 2 diabetes.
source →Type II diabetes is a known risk factor for heart failure, particularly through the progressive development of diabetic cardiomyopathy. Cardiac metabolic parameters, including myocardial steatosis and epicardial fat, are altered in diabetic patients.
source →The researchers are trying to identify the specific characteristics (phenotypes) that may be useful to help select the right medication for weight loss.
source →This study is conducted in Europe. The aim of this study is to investigate Long-Term Effectiveness of Liraglutide for Treatment of Type 2 Diabetes in daily Practice.
source →The investigators planned to research the cardioprotective effects of intravenous liraglutide on reperfusion injury.
source →Non-alcoholic fatty liver disease (NAFLD) is commonly associated with obesity, metabolic syndrome and type 2 diabetes. NAFLD, in patients with type 2 diabetes, has been shown to be associated with lipid abnormalities (such as hypertriglyceridemia and decreased HDL-cholesterol) and increased cardiovascular risk.
source →Malaysia has increasing challenges in lifestyle related diseases, which is related to eating habits and disorders.
source →Glucagon-like Peptide-1 (GLP-1) is an important incretin hormone which acts as a powerful insulin secretagogue. Defects in GLP-1 synthesis and secretion are thought to be part of the pathogenesis of type 2 diabetes.
source →