FOXO4-DRI
aka FOXO4-D-Retro-Inverso
Mechanism
FOXO4-DRI is a D-retro-inverso peptide designed to disrupt the FOXO4-p53 interaction in senescent cells. It is studied as a senolytic agent that selectively induces apoptosis in senescent cells while sparing normal cells.
Identification
| CAS number | 2460055-10-9 |
|---|---|
| Molecular formula | C228H388N86O64 |
| Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG |
| Typical dose | 1 mg subcutaneous, repeated on alternating days (e.g. days 1, 3, 5) per cycle; original mouse research used 5 mg/kg × 3 doses |
| Half-life | ~2–6 hours (estimated preclinical; no human PK data available) |
Vendors selling FOXO4-DRI
| Vendor | Size | Price | Listed purity | Trust |
|---|---|---|---|---|
| Glacier Aminos | 10 mg | $134.99 | — | 99 |
| BioLongevity Labs | 10 mg | $274.97 | — | 96 |
| Orbitrex Peptides | 10 mg | $189.99 | — | 95 |
| Ion Peptide | 10 mg | $119.00 | — | 95 |
| Peptide Tech | 10 mg | $148.99 | — | 94 |
| Skye Peptides | 15 mg | $169.00 | — | 90 |
| Qihang Peptide | — | — | — | 87 |
| Verified Peptides | 10 mg | $220.00 | — | 86 |
| Simple Peptide | — | $180.00 | — | 85 |
| Peptidegurus | 10 mg | — | — | 84 |
| Cocer Peptides | 10 mg | $500.00 | — | 82 |
| OROS Research | 10 mg | — | — | 79 |
| MEI-PEPETIDE | 10 mg | $221.00 | — | 48 |
| MJT peptides | 10 mg | $375.00 | — | 39 |
| Apollo Peptide Sciences | 10 mg | — | — | — |
| AMC Essentials | 10 mg | $99.99 | — | — |
| Alpha Omega | 10 mg | $180.00 | — | — |
| Atomik Labz | 14 mg | $199.00 | — | — |
| Biotech Peptides | 10 mg | $270.00 | — | — |
| Core Peptides | 10 mg | $235.00 | — | — |
| Kimera Chems | — | $151.99 | — | — |
| Oasis Labs | 10 mg | $217.50 | — | — |
| Paramount Peptides | 15 mg | $300.00 | — | — |
| Peptide Crafters | 12 mg | $165.00 | — | — |
| Polaris Peptides | 10 mg | $250.00 | — | — |
| Solution Peptides | 14 mg | $199.00 | — | — |
Research
Cellular senescence, driven by the interaction between FOXO4 and p53, is increasingly recognized as a crucial mechanism in brain aging and the development of neurodegenerative disorders.
source →Temozolomide (TMZ) is still the first-line drug for glioblastoma (GBM) treatment though tumor cell resistance remains a major challenge.
source →Pulmonary arterial hypertension (PAH) is a fatal vasculopathy driven by proinflammatory signaling that leads to pulmonary vascular remodeling and ultimately, right ventricular failure. Existing therapies fail to eliminate dysfunctional cells or reverse pathologic remodeling.
source →Objectives Endothelial cell dysfunction during aging is a key driver of vascular aging and related diseases; however, effective strategies to selectively eliminate senescent endothelial cells and restore vascular function remain lacking.
source →A central process contributing to the phenotype of aging is cellular senescence. We recently identified the FOXO4 - p53 axis as pivotal in maintaining the viability of senescent cells, and that senescent cells can be targeted selectively with the senolytic peptide FOXO4-DRI.
source →Keloids are pathological scars exhibiting tumour-like aggressiveness and high recurrence rate.
source →Brain aging is a progressive process marked by cellular dysfunction, chronic inflammation, and increased susceptibility to neurodegenerative diseases.
source →The forkhead frame O protein (forkhead box class O proteins, FOXOs) is a highly conserved family of transcription factors, consisting of four members: FOXO 1, FOXO 3, FOXO 4, and FOXO 6.
source →Cellular senescence is a fundamental contributor to numerous dysfunctions and degenerative diseases, including osteoporosis. In genetically modified and preclinical animal models, therapeutic strategies targeting persistent senescent cells have been shown to delay and prevent osteoporosis.
source →Male ageing is always accompanied by decreased fertility. The forkhead O (FOXO) transcription factor FOXO4 is reported to be highly expressed in senescent cells. Upon activation, it binds p53 in the nucleus, preventing senescent cell apoptosis and maintaining senescent cells in situ.
source →Autologous chondrocyte implantation (ACI) is a procedure used to treat articular cartilage injuries and prevent the onset of post-traumatic osteoarthritis.
source →Male late-onset hypogonadism is an age-related disease, the core mechanism of which is dysfunction of senescent Leydig cells. Recent studies have shown that elimination of senescent cells can restore proper homeostasis to aging tissue.
source →