CJC-1295
aka CJC-1295 with DAC
Mechanism
CJC-1295 is a synthetic tetrasubstituted analog of growth hormone-releasing hormone (GHRH 1-29) originally developed by ConjuChem. The name historically refers to the DAC-modified (Drug Affinity Complex) form that covalently binds serum albumin, producing a 6–8 day half-life; a separate no-DAC form (also called Modified GRF 1-29) shares the same tetrasubstituted backbone but lacks the albumin-linking maleimidopropionyl-lysine and has a half-life of roughly 30 minutes. Not FDA-approved in any form; ConjuChem halted Phase 2 development around 2007 after a patient death in an HIV-lipodystrophy trial (ultimately judged by investigators to be unrelated to the drug, but development was terminated regardless).
Identification
| CAS number | 446262-90-4 |
|---|---|
| Molecular formula | C165H269N47O46 |
| Sequence | YADAIFTQSYRKVLAQLSARKLLQDILSRK |
| Typical dose | 1–2 mg/week subcutaneous (research protocols); published human RCTs used 30–120 mcg/kg single injection |
| Half-life | ~6–8 days (human; albumin-bound via DAC) |
Vendors selling CJC-1295
| Vendor | Size | Price | Listed purity | Trust |
|---|---|---|---|---|
| Glacier Aminos | 5 mg | $51.99 | — | 99 |
| Glacier Aminos | 10 mg | $67.99 | — | 99 |
| Glacier Aminos | 10 mg | $56.99 | — | 99 |
| Moglabs | 5 mg | $50.00 | — | 96 |
| BioLongevity Labs | — | $199.97 | — | 96 |
| BioLongevity Labs | 10 mg | $99.97 | — | 96 |
| Profound Aminos | 5 mg | $39.00 | — | 95 |
| Reta One Labs | 5 mg | $37.00 | — | 95 |
| Licensed Peptides | 10 mg | $539.95 | — | 95 |
| Licensed Peptides | 5 mg | $38.99 | — | 95 |
| Licensed Peptides | 10 mg | $38.99 | — | 95 |
| Licensed Peptides | 5 mg | $91.99 | — | 95 |
| Licensed Peptides | 10 mg | $91.99 | — | 95 |
| Peptide Tech | 5 mg | $53.99 | — | 94 |
| Mile High Compounds | — | $59.99 | — | 94 |
| Forge Performance Co. | 10 mg | $60.00 | — | 94 |
| Riptide Wellness | — | $74.99 | — | 92 |
| Hydro Research Peptides | 5 mg | $0.30 | — | 91 |
| Hydro Research Peptides | — | $0.60 | — | 91 |
| Skye Peptides | 12.5 mg | $89.00 | — | 90 |
| Peptidology | 5 mg | $61.99 | — | 89 |
| Peptidology | 5 mg | $44.99 | — | 89 |
| Qihang Peptide | — | — | — | 87 |
| Verified Peptides | 10 mg | $68.00 | — | 86 |
| Verified Peptides | 5 mg | $41.99 | — | 86 |
| EZ Peptides | 5 mg | $38.00 | — | 85 |
| Simple Peptide | 10 mg | $115.00 | — | 85 |
| Simple Peptide | 5 mg | $35.00 | — | 85 |
| Simple Peptide | 5 mg | $70.00 | — | 85 |
| Peptidegurus | 2 mg | — | — | 84 |
| Peptidegurus | 5 mg | — | — | 84 |
| Ascension Peptides | 10 mg | $73.00 | — | 84 |
| Ascension Peptides | 10 mg | $118.00 | — | 84 |
| Ascension Peptides | 5 mg | $70.00 | — | 84 |
| Ascension Peptides | 5 mg | $50.00 | — | 84 |
| Reta Peptide | — | — | — | 83 |
| Cocer Peptides | 5 mg | $180.00 | — | 82 |
| MedGe Peptides | 10 mg | $75.00 | — | 82 |
| Blank Peptides | 5 mg | $50.00 | — | 81 |
| Blank Peptides | 5 mg | $50.00 | — | 81 |
| OROS Research | 10 mg | — | — | 79 |
| OROS Research | 2 mg | — | — | 79 |
| OROS Research | 5 mg | — | — | 79 |
| OROS Research | 10 mg | — | — | 79 |
| Crystal Peptides | 5 mg | $47.00 | — | 66 |
| Crystal Peptides | 5 mg | $39.97 | — | 66 |
| Crystal Peptides | 10 mg | $69.99 | — | 66 |
| Qing Li Peptide | — | — | — | 63 |
| Qing Li Peptide | — | — | — | 63 |
| Peptiatlas | — | — | — | 51 |
| MEI-PEPETIDE | 2 mg | $68.00 | — | 48 |
| DongCheng Peptide | 5 mg | — | — | 46 |
| DongCheng Peptide | — | — | — | 46 |
| DongCheng Peptide | — | — | — | 46 |
| Mandy | 2 mg | $62.00 | — | 43 |
| HongDa Peptide | — | $86.00 | — | 43 |
| HongDa Peptide | — | $123.00 | — | 43 |
| HongDa Peptide | — | $43.00 | — | 43 |
| HongDa Peptide | — | $43.00 | — | 43 |
| zztai Peptide Ltd | 5 mg | — | — | 43 |
| zztai Peptide Ltd | — | — | — | 43 |
| MJT peptides | 2 mg | $78.00 | — | 39 |
| Alpha Peptides | — | — | — | — |
| AMC Essentials | 5 mg | $39.99 | — | — |
| Alpha Omega | — | $35.00 | — | — |
| Alpha Omega | 5 mg | $70.00 | — | — |
| Arcane Peptides | 5 mg | $70.00 | — | — |
| Arcane Peptides | — | $40.00 | — | — |
| Atomik Labz | 10 mg | $64.00 | — | — |
| Atomik Labz | 10 mg | $117.00 | — | — |
| Atomik Labz | 5 mg | $45.00 | — | — |
| Atomik Labz | 5 mg | $33.00 | — | — |
| Atomik Labz | 5 mg | $59.00 | — | — |
| Biotech Peptides | 10 mg | $84.00 | — | — |
| Biotech Peptides | 9 mg | $80.00 | — | — |
| Biotech Peptides | 10 mg | $81.00 | — | — |
| Biotech Peptides | 10 mg | $86.00 | — | — |
| Biotech Peptides | 5 mg | $52.00 | — | — |
| Bulk Peptides | 5 mg | $200.00 | — | — |
| Bulk Peptides | 5 mg | $300.00 | — | — |
| Core Peptides | 10 mg | $87.00 | — | — |
| Core Peptides | 10 mg | $84.00 | — | — |
| Core Peptides | 5 mg | $41.00 | — | — |
| Core Peptides | 9 mg | $81.00 | — | — |
| Core Peptides | 10 mg | $80.00 | — | — |
| Core Peptides | 10 mg | $69.00 | — | — |
| Core Peptides | 5 mg | $52.00 | — | — |
| Genetic Peptide | 25 mg | $200.00 | — | — |
| Genetic Peptide | 25 mg | $200.00 | — | — |
| Genetic Peptide | 10 mg | $95.00 | — | — |
| Genetic Peptide | 2 mg | $39.00 | — | — |
| Genetic Peptide | 5 mg | $39.00 | — | — |
| Genetic Peptide | 10 mg | $39.00 | — | — |
| Genetic Peptide | 5 mg | $55.00 | — | — |
| Genetic Peptide | 10 mg | $55.00 | — | — |
| Ignite Peptides | 10 mg | $50.00 | — | — |
| Kimera Chems | 5 mg | $81.99 | — | — |
| Kimera Chems | — | $51.99 | — | — |
| Kimera Chems | — | $61.99 | — | — |
| Lumi Peptides | — | $53.00 | — | — |
| Modern Research Peptides | — | $29.99 | — | — |
| Nextech Labs | 5 mg | $498.75 | — | — |
| Nextech Labs | 5 mg | $75.00 | — | — |
| Nextech Labs | 5 mg | $52.50 | — | — |
| Nova Peptides | 5 mg | $69.99 | — | — |
| Oasis Labs | 5 mg | $42.00 | — | — |
| Oasis Labs | 5 mg | $84.00 | — | — |
| Paramount Peptides | 10 mg | $75.00 | — | — |
| Paramount Peptides | 10 mg | $75.00 | — | — |
| Peptide Crafters | 5 mg | $55.00 | — | — |
| Peptide Crafters | 5 mg | $30.00 | — | — |
| Peptide Crafters | 12 mg | $45.00 | — | — |
| Peptira | — | $39.00 | — | — |
| Peptira | — | $79.00 | — | — |
| Pepvida Labs | 5 mg | $69.00 | — | — |
| Pepvida Labs | 5 mg | $30.00 | — | — |
| Polaris Peptides | 5 mg | $60.00 | — | — |
| Polaris Peptides | 10 mg | $60.00 | — | — |
| Puratek Peptides | 10 mg | $44.95 | — | — |
| Solution Peptides | 10 mg | $64.00 | — | — |
| Solution Peptides | 10 mg | $117.00 | — | — |
| Solution Peptides | 5 mg | $45.00 | — | — |
| Solution Peptides | 5 mg | $59.00 | — | — |
| Solution Peptides | 5 mg | $33.00 | — | — |
| Soma Peptides | 2 mg | $39.00 | — | — |
| Soma Peptides | 5 mg | $39.00 | — | — |
| Soma Peptides | 10 mg | $85.00 | — | — |
| Soma Peptides | 5 mg | $72.00 | — | — |
| Southern Aminos | — | $41.25 | — | — |
| Welli Labs | — | $44.99 | — | — |
| Welli Labs | — | $32.99 | — | — |
| Wellness Peptides | — | $60.00 | — | — |
Research
Performance-enhancing drugs (PEDs) marketed as "research compounds" include unregulated peptides intended to modulate the growth hormone-insulin-like growth factor-1 (GH-IGF-1) axis.
source →Background Peptide therapeutics represent an emerging frontier in gerontological medicine, targeting fundamental hallmarks of aging including metabolic dysfunction, telomere attrition, tissue repair impairment, and hormonal decline.
source →Therapeutic peptides are short chains of amino acids used to treat metabolic and endocrine conditions such as obesity and type 2 diabetes.
source →Background Therapeutic peptides are short-chain amino acids that regulate cellular functions and facilitate biochemical processes. In recent years, there has been significant growth in the global market for therapeutic peptides and thus its popularity among patients.
source →Peptides are short chains of amino acids with a unique pharmacological niche between small-molecule drugs and large proteins. Their use in sports medicine is rapidly expanding, driven by patient demand for accelerated injury recovery and performance enhancement.
source →Background Injectable peptides are increasingly promoted for musculoskeletal recovery, tissue repair, and performance enhancements; however, clinical adoption has outpaced high-quality evidence and regulatory consensus.
source →The pursuit of pharmacological enhancement in sport has evolved from the widespread use of anabolic-androgenic steroids (AAS) to novel agents such as peptides and peptide analogues.
source →CJC-1295 is a peptide-based drug that stimulates the production of growth hormone (GH) from the pituitary gland. It incorporates a functional maleimido group at the C-terminus that allows it to covalently bind plasma proteins such as serum albumin.
source →CJC-1295 is a 30 amino acid peptide-based drug that stimulates the release of growth hormone (GH) from the pituitary gland.
source →Background Communal online folk pharmacology fuels the drive for short cuts in attaining muscle enhancement, fat loss, and youthful skin. Objectives The study used "netnography" to explore female use of CJC-1295, a synthetic growth hormone analogue from the perspectives contained in Internet forum activity.
source →Several peptide drugs are being manufactured illicitly, and in some cases they are being made available to the public before entering or completing clinical trials.
source →Small human PK/PD RCT: CJC-1295 produced sustained increases in GH and IGF-1 secretion. Human evidence is limited to short-term endocrine pharmacology — no clinical-outcome trials.
source →This is a multicenter, randomized, placebo-controlled, double-blind, Phase 2 study. Patients will be treated for a total of 12 weeks. There will be a 6 week follow-up period after the treatment period ends. Patients will be randomly assigned to low dose CJC 1295, high dose CJC 1295 or placebo.
source →